PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00004976001
Common NameGSBRNA2T00004976001, LOC106415917
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 317aa    MW: 35051.1 Da    PI: 7.5199
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00004976001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.42.5e-4391081100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrrkC+++Cv+apyfp +qp+kfa+vhk+FGasnv kll++l  ++reda++sl+yeAear+rdPvyG+vg+i+ lq++l+ql
  GSBRNA2T00004976001   9 PCAACKFLRRKCTQECVFAPYFPPDQPHKFAYVHKIFGASNVAKLLNDLASNQREDAVNSLFYEAEARLRDPVYGCVGLISILQHRLKQL 98 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +++l+ +k+e
  GSBRNA2T00004976001  99 QHDLDNAKKE 108
                          ****999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381551.1E-876311IPR017414LOB domain-containing protein 10/36/41
PROSITE profilePS5089127.0598109IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-429106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MTSSTSSSPC AACKFLRRKC TQECVFAPYF PPDQPHKFAY VHKIFGASNV AKLLNDLASN  60
QREDAVNSLF YEAEARLRDP VYGCVGLISI LQHRLKQLQH DLDNAKKELA AYVAPNAMFP  120
MHHPQPHFMS LPPQPQQPSS ASSSASVLTQ QQQHLNLLPV LAIPTEQLLY HQQHIFEAQQ  180
LAAVNSVSRD QLNEMFRAYG GGSISPHHHH NQPQFDILRF NSGFGSVPTG SVTVTGFNQL  240
SSSGTTITGM SPSLALGDSF VDSPSTNDNY HRDQQLQHQR HQQQSFQQLP LQTQETQTHP  300
NSKSEEGRGS IIGSSR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00004976001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013712186.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ31e-137LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A078IM440.0A0A078IM44_BRANA; BnaA02g34590D protein
STRINGBra012112.1-P1e-159(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80082441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-116ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]